Zu "GeneID 338324" wurden 6 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Human S100A15 (S100 Calcium Binding Protein A15) ELISA Kit
Artikelnummer: ELK-ELK7320.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A15. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A15....
| Schlagworte: | S100A7A, S100A15, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 365,00 €
Anti-S100A7A
Artikelnummer: ELK-ES13279.100
function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
| Schlagworte: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 169,00 €
Anti-S1A7A
Artikelnummer: ELK-ES10066.100
function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
| Schlagworte: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 169,00 €
Anti-S100A15 (S100 Calcium Binding Protein A15, S100A7A,...
Artikelnummer: 364956.200
The human calcium-binding protein (hS100A15) was first identified in inflamed hyperplastic psoriatic skin, where the S100A15 gene is transcribed into two mRNA splice variants, hS100A15-S and hS100A15-L. In cultured keratinocytes, IL-1beta and Th1 cytokines significantly induced hS100A15-L compared with hS100A15-S....
| Schlagworte: | Anti-S100A15, Anti-S100A7A, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A7A, Anti-S100 calcium-binding... |
| Anwendung: | ELISA, ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
612,00 €
S100A7A, Recombinant, Human, aa2-101, His-SUMO-Tag...
Artikelnummer: 375182.100
Source:, Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ, Storage and Stability: May be stored at...
| Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| MW: | 27,2 |
ab 511,00 €
S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein...
Artikelnummer: 375183.100
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. Source: Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD, AA Sequence:...
| Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| MW: | 13,2 |
ab 531,00 €